PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr001078.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRF
Protein Properties Length: 594aa    MW: 64242.3 Da    PI: 7.6197
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr001078.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.62.6e-24215259145
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                  d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  Pbr001078.1 215 DPEPGRCRRTDGKKWRCSRDAVQDQKYCERHINRGRHRSRKPVEG 259
                  79****************************************985 PP

2QLQ59.87.6e-21149185137
          QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                  ++FT++Q+ +L++Q+l+yKy+ +n+PvP++Ll +i+k
  Pbr001078.1 149 GPFTPSQWIELEHQALIYKYMTSNVPVPSNLLIPIKK 185
                  59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.7E-12149185IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.2E-14150183IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.966150185IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.532215259IPR014977WRC domain
PfamPF088791.0E-20216258IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 594 aa     Download sequence    Send to blast
MDFGVMGLEG LVGPDAGGGE AVENVGDGSG SASAKQQRSW PAEDDWRDSK MLKNEDLNSP  60
KTMPLQYQGT PLLRSNSQLL PPPAESHRQE QMLSFSNNKS ESFLSKDGDF AYYQRNPTPI  120
PSPYPRNAGS PGYGSLNLSM HGTFTGARGP FTPSQWIELE HQALIYKYMT SNVPVPSNLL  180
IPIKKSLYPY GLSGPSNPTS IAWGTYHLGF SGNNDPEPGR CRRTDGKKWR CSRDAVQDQK  240
YCERHINRGR HRSRKPVEGQ PGQAVSGTSN SKRVPMNSSM STSVMPSSGA SSSLTTTQQQ  300
FKSLQPAVAA NPSADALVNR MQGQQGVSVM SAPTLKLKSN NSTYNIGKQE FLVEEASQAE  360
FGLVSTDSLL NPSHRNSYIS KDFSGSFLHF GDQDTQDHHP LRQFMDDWPK DQSCHSVPTW  420
PEEVKSDWTQ LSMSIPMASS EFSSSSSSPK HEKLALSPLR LSREFEPAQM NLGISKDISE  480
SSQKQTNWIP ITWGNSMGGP LGEVLTKTTS GGSKICINSK SPLSLLNEGW DGSPQLGSSP  540
TGVLQKSTFC SLSNSSSGSS PRGGENKKSS LDGASIYDDV LGSTFASSSV PSL*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0561592e-82EU056159.1 Eriobotrya japonica clone ssrEJ102 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009362603.10.0PREDICTED: growth-regulating factor 1-like isoform X1
TrEMBLD9ZIZ80.0D9ZIZ8_MALDO; GRF domain class transcription factor
STRINGVIT_00s0494g00010.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20853481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.11e-111growth-regulating factor 1